PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_22890V3.2.p
Common NameMADS2, PHYPADRAFT_166549, PpMADS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 418aa    MW: 46722.4 Da    PI: 7.4452
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_22890V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.23.7e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien +nrqvt+skRrng++KKA+ELSvLCd++ a+i+fs++gkl  y++
  Pp3c12_22890V3.2.p  9 KKIENPTNRQVTYSKRRNGLIKKAYELSVLCDIDLALIMFSPSGKLTQYCN 59
                        68***********************************************85 PP

2K-box17.71.5e-07131201572
               K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGed..Les.LslkeLqqLeqqLekslkkiRskKnel 72 
                         sg++ ++ +ae lqqel+k ++e e  q+  R +l ++  L+   s+++L ++e++Le++l+++R++Kn +
  Pp3c12_22890V3.2.p 131 SGSKSSSYEAEVLQQELKKAQQEKELVQQRARLYLADEqlLQGvTSVQQLANMETELEQALERVRARKNYV 201
                         66678888999*****************9999888765444442589*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.875161IPR002100Transcription factor, MADS-box
CDDcd002651.86E-37273No hitNo description
SuperFamilySSF554554.84E-31288IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.02140240IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGRVKLEIKK IENPTNRQVT YSKRRNGLIK KAYELSVLCD IDLALIMFSP SGKLTQYCNC  60
SIEEVIARFA NLPMHERNKS FEDMLTRFAN NQMHHDRSKY TRKIENLEYL HKALKKLAGE  120
KDLVSNQQLL SGSKSSSYEA EVLQQELKKA QQEKELVQQR ARLYLADEQL LQGVTSVQQL  180
ANMETELEQA LERVRARKNY VSSAYQTANA LQRQQHEFLG NSLQMMALRQ QQQQQQQQAG  240
MGGTPSFLHW TMQSERPEPT QDFMEQQTNS SASLMPAPLS IREPGSNGEA NPAAAAYFPA  300
GPQPGALESL RQMGMAAASR GLTMHEMSLE QPNGQYIEDQ QKKAKVEGSM GFATSSSAAE  360
AVSENTVTRD HQQSEQTDVN GGAADWPPHP ANHHPNAFTN GGLFSSFSQN GHHPAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-18269168Myocyte-specific enhancer factor 2A
3mu6_C9e-18269168Myocyte-specific enhancer factor 2A
3mu6_B9e-18269168Myocyte-specific enhancer factor 2A
3mu6_A9e-18269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1350.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0676890.0AB067689.1 Physcomitrella patens PpMADS2 mRNA for MADS-box protein PpMADS2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769790.10.0MIKC MADS-domain protein PpMADS2
RefseqXP_001769789.10.0ppmads2 MIKC* MADS-domain protein PpMADS2
TrEMBLA9STY70.0A9STY7_PHYPA; MIKC MADS-domain protein PpMADS2
STRINGPP1S118_161V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-33AGAMOUS-like 104
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]